Metabotropic Glutamate Receptor 6 (GRM6) Rabbit Polyclonal Antibody

CAT#: TA330620

Rabbit Polyclonal Anti-GRM6 Antibody

Product Images

WB Suggested Anti-GRM6 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

• 

  Lanes: ; Lane 1: 10 ug WT mouse retina lysate; Lane 2: 10 ug GRM6 knockout mouse retina lysate; Primary Antibody Dilution: ; 1:1000; Secondary Antibody: ; Anti-rabbit HRP; Secondary Antibody Dilution: ; 1:10000; Gene Name: ; GRM6; Submitted by: ; Anonymous;

• 

  Host: Rabbit; Target Name: GRM6; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the C terminal of human GRM6. Synthetic peptide located within the following region: ITFSLTSLQVVGMIAWLGARPPHSVIDYEEQRTVDPEQARGVLKCDMSDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: glutamate metabotropic receptor 6
• Database Link:
  NP_000834
  Entrez Gene 108072 MouseEntrez Gene 2916 Human
  UniProt ID O15303
• Background: L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. GRM6 is part of Group III which is linked to the inhibition of the cyclic AMP cascade.
• Synonyms: CSNB1B; GPRC1F; mGlu6; MGLUR6
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction