Primary Antibodies

View as table Download

Goat Polyclonal Antibody against PPP2CA / PPP2CB

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EPHVTRRTPDYFL, from the C Terminus of the protein sequence according to NP_002706.1; NP_004147.1.

Rabbit Polyclonal Anti-PPP2CA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP2CA Antibody is: synthetic peptide directed towards the N-terminal region of Human PPP2CA. Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI

Rabbit Polyclonal Anti-PPP2CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP2CA