PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody

CAT#: TA335806

Rabbit Polyclonal Anti-PPP2CA Antibody

Product Images

Host: Rabbit; Target Name: PPP2CA; Sample Tissue: PANC1 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PPP2CA Antibody is: synthetic peptide directed towards the N-terminal region of Human PPP2CA. Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: protein phosphatase 2 catalytic subunit alpha
• Database Link:
  NP_002706
  Entrez Gene 19052 MouseEntrez Gene 5515 Human
  UniProt ID P67775
• Background: This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit.
• Synonyms: PP2Ac; PP2CA; PP2Calpha; RP-C
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 93%

Reference Data

• Protein Families: Druggable Genome, Phosphatase, Transcription Factors
• Protein Pathways: Long-term depression, Oocyte meiosis, TGF-beta signaling pathway, Tight junction, Wnt signaling pathway