Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MOS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MOS Antibody: A synthesized peptide derived from human MOS

Rabbit polyclonal anti-MOS antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MOS.

Rabbit polyclonal Anti-MOS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MOS antibody: synthetic peptide directed towards the middle region of human MOS. Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG