MOS Rabbit Polyclonal Antibody

CAT#: TA342241

Rabbit polyclonal Anti-MOS Antibody

Product Images

WB Suggested Anti-MOS Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: NCI-H226 cell lysateMOS is supported by BioGPS gene expression data to be expressed in NCIH226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MOS antibody: synthetic peptide directed towards the middle region of human MOS. Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: v-mos Moloney murine sarcoma viral oncogene homolog
• Database Link:
  NP_005363
  Entrez Gene 4342 Human
  UniProt ID P00540
• Background: MOS is a serine/threonine kinase that activatesThe MAP kinase cascade through direct phosphorylation ofThe MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]). [supplied by OMIM, Jul 2009]. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript is intronless :: BC069569.1, BC069590.1 [ECO:0000345] ##Evidence-Data-END##
• Synonyms: MSV
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Bovine: 92%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: MAPK signaling pathway, Oocyte meiosis, Progesterone-mediated oocyte maturation, Regulation of actin cytoskeleton