Primary Antibodies

View as table Download

CRKL rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Polyclonal Antibody against CRKL

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KIFDPQNPDENE, from the C Terminus of the protein sequence according to NP_005198.

Rabbit monoclonal antibody against Phospho CrkL (pY207)(EP270Y) (phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications Phospho-specific

CRKL pTyr207 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

CRKL rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Rabbit Polyclonal anti-CRKL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRKL antibody is: synthetic peptide directed towards the middle region of Human CRKL. Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS

Rabbit Polyclonal Anti-CRKL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRKL