Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RPL13A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL13A antibody: synthetic peptide directed towards the middle region of human RPL13A. Synthetic peptide located within the following region: HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY

Rabbit Polyclonal Anti-SPAG4L Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPAG4L antibody: synthetic peptide directed towards the N terminal of human SPAG4L. Synthetic peptide located within the following region: MPRSSRSPGDPGALLEDVAHNPRPRRIAQRGRNTSRMAEDTSPNMNDNIL

Rabbit Polyclonal antibody to RPL13A (ribosomal protein L13a)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 203 of RPL13A (Uniprot ID#P40429)