RPL13A Rabbit Polyclonal Antibody

CAT#: TA344300

Rabbit Polyclonal Anti-RPL13A Antibody - middle region

Product Images

WB Suggested Anti-RPL13A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: COLO205 cell lysateRPL13A is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RPL13A antibody: synthetic peptide directed towards the middle region of human RPL13A. Synthetic peptide located within the following region: HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: ribosomal protein L13a
• Database Link:
  NP_036555
  Entrez Gene 23521 Human
  UniProt ID P40429
• Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro
• Synonyms: L13A; TSTA1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 91%; Sheep: 86%

Reference Data

• Protein Pathways: Ribosome