Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-BPNT1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BPNT1 antibody: synthetic peptide directed towards the N terminal of human BPNT1. Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP

BPNT1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 276-305 amino acids from the C-terminal region of human BPNT1

Goat Polyclonal Antibody against BPNT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RNYDYYASRVPESIK, from the C Terminus of the protein sequence according to NP_006076.4.