Rabbit polyclonal anti-Actin-gamma2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Actin-?2. |
Rabbit polyclonal anti-Actin-gamma2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Actin-?2. |
Rabbit Polyclonal Anti-Actin-gamma2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Actin-gamma2 Antibody: A synthesized peptide derived from human Actin-gamma2 |
ACTG2 (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic N-Terminal Actin-gamma2 peptide - KLH conjugated |
Rabbit Polyclonal Anti-ACTG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTG2 antibody is: synthetic peptide directed towards the C-terminal region of Human ACTG2. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRK |