Primary Antibodies

View as table Download

Rabbit polyclonal anti-Actin-gamma2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Actin-?2.

Rabbit Polyclonal Anti-Actin-gamma2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Actin-gamma2 Antibody: A synthesized peptide derived from human Actin-gamma2

ACTG2 (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic N-Terminal Actin-gamma2 peptide - KLH conjugated

Rabbit Polyclonal Anti-ACTG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTG2 antibody is: synthetic peptide directed towards the C-terminal region of Human ACTG2. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRK