Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
USD 440.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
| Applications | FC, IHC, WB |
| Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal anti-CACNA1D Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal MYH11 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYH11 antibody: human MYH11 (Myosin, Heavy Chain 11) using two KLH-conjugated synthetic peptides containing sequences from the C-terminal region of the protein. |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Goat Anti-CACNA1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Rabbit Polyclonal Anti-MYL6 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYL6 antibody: synthetic peptide directed towards the middle region of human MYL6. Synthetic peptide located within the following region: PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT |
Rabbit Polyclonal Anti-GNAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
Rabbit Polyclonal Anti-CALCRL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
Rabbit Polyclonal Anti-alpha-SMA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-alpha-SMA antibody: Synthetic peptide corresponding to N terminal residues of Human alpha smooth muscle Actin. |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal Anti-CYP4A22 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
Rabbit Polyclonal Anti-AGTR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Goat Anti-Ramp1 (C-Term., mouse) Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DYQSKRTEGIV, from the C-Terminus of the protein sequence according to NP_058590.1; NP_848488.2. |
Rabbit anti-GNAS Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAS |
Rabbit Polyclonal Anti-ADCY6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
Goat Polyclonal Anti-ADRA1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADRA1B Antibody: Peptide with sequence C-SSTKAKGHNPRSS, from the internal region of the protein sequence according to NP_000670.1. |
USD 524.00
In Stock
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Germany
Japan
United Kingdom
China
