Myosin (MYL6) Rabbit Polyclonal Antibody

CAT#: TA344641

Rabbit Polyclonal Anti-MYL6 Antibody - middle region

Product Images

WB Suggested Anti-MYL6 Antibody Titration: 1 ug/ml; Positive Control: HepG2 cell lysateMYL6 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0 ug/ml using anti-MYL6 antibody

• 

  Human Prostate

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYL6 antibody: synthetic peptide directed towards the middle region of human MYL6. Synthetic peptide located within the following region: PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: myosin light chain 6
• Database Link:
  NP_524147
  Entrez Gene 4637 Human
  UniProt ID P60660
• Background: MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.
• Synonyms: ESMLC; LC17; LC17-GI; LC17-NM; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Vascular smooth muscle contraction