Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ASS Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ASS antibody: synthetic peptide directed towards the C terminal of human ASS. Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE |
Rabbit Polyclonal Anti-ASS Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ASS antibody: synthetic peptide directed towards the N terminal of human ASS. Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF |
Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 198 of ASS1 (Uniprot ID#P00966) |
ASS1 (196-212) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide from an internal region of human ASS1 |
Goat Polyclonal Antibody against Argininosuccinate synthetase 1
Applications | WB |
Reactivities | Human, Cow |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ENPKNQAPPGLYTKTQD, from the internal region of the protein sequence according to NP_000041.2 ; NP_446464.1. |
ASS1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 280-310 amino acids from the C-terminal region of human ASS1 |
ASS1 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ASS |
Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 155 and 412 of ASS1 (Uniprot ID#P00966) |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI8C4 (formerly 8C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI14C1 (formerly 14C1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI3D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI8H4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI12G1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ASS1 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ASS1 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ASS1 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody, clone OTI8C4 (formerly 8C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody, clone OTI8C4 (formerly 8C4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ASS1 mouse monoclonal antibody, clone OTI8C4 (formerly 8C4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ASS1 mouse monoclonal antibody, clone OTI8C4 (formerly 8C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ASS1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ASS1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ASS1 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ASS1 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ASS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ASS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody, clone OTI14C1 (formerly 14C1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ASS1 mouse monoclonal antibody, clone OTI14C1 (formerly 14C1), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ASS1 mouse monoclonal antibody, clone OTI14C1 (formerly 14C1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ASS1 mouse monoclonal antibody, clone OTI14C1 (formerly 14C1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody,clone OTI3D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody,clone OTI3D1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ASS1 mouse monoclonal antibody,clone OTI3D1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ASS1 mouse monoclonal antibody,clone OTI3D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody,clone OTI8H4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ASS1 mouse monoclonal antibody,clone OTI8H4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ASS1 mouse monoclonal antibody,clone OTI8H4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ASS1 mouse monoclonal antibody,clone OTI8H4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |