Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CAB39L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAB39L antibody: synthetic peptide directed towards the N terminal of human CAB39L. Synthetic peptide located within the following region: EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI

Rabbit Polyclonal Anti-CAB39L Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CAB39L