CAB39L Rabbit Polyclonal Antibody

CAT#: TA343048

Rabbit Polyclonal Anti-CAB39L Antibody

Product Images

WB Suggested Anti-CAB39L Antibody; Titration: 1.0 ug/ml; Positive Control: COLO205 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAB39L antibody: synthetic peptide directed towards the N terminal of human CAB39L. Synthetic peptide located within the following region: EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: calcium binding protein 39 like
• Database Link:
  NP_112187
  Entrez Gene 81617 Human
  UniProt ID Q9H9S4
• Background: The function of this protein remains unknown.
• Synonyms: bA103J18.3; MO2L; MO25-BETA
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Pathways: mTOR signaling pathway