Primary Antibodies

Jump to Filters
View as table Download
SESN2 Rabbit Polyclonal Antibody
TA349102

USD 484.00

5 Days

Rabbit Polyclonal Anti-KIRREL2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KIRREL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human KIRREL2.
SESN2 Rabbit Polyclonal Antibody
TA343006

USD 375.00

5 Days

Rabbit Polyclonal Anti-SESN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SESN2 antibody: synthetic peptide directed towards the N terminal of human SESN2. Synthetic peptide located within the following region: LKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESL
SESN2 (Center) Rabbit Polyclonal Antibody
AP18193PU-N

USD 450.00

2 Weeks

SESN2 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human Sestrin-2
SESN2 Rabbit Polyclonal Antibody
TA351659

USD 345.00

In Stock

Rabbit Polyclonal Anti-SESN2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SESN2
SESN2 Rabbit Polyclonal Antibody
TA357715

USD 360.00

5 Days

SESN2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated