Primary Antibodies

View as table Download

CXCL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CXCL1

Rabbit polyclonal anti-CXCL1 (KC) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 78 of mouse KC

Rabbit Polyclonal Anti-GRO alpha

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRO alpha: A synthesized peptide derived from human GRO alpha

Anti-Human GRO/MGSA Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GRO/MGSA (CXCL1)

Rabbit anti-CXCL1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CXCL1

Biotinylated Anti-Human GRO/MGSA Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GRO/MGSA (CXCL1)

Rabbit Polyclonal Anti-CXCL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL1 antibody: synthetic peptide directed towards the middle region of human CXCL1. Synthetic peptide located within the following region: QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

CXCL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CXCL1