Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PRMT3 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK

Goat Anti-PRMT3 (aa468-421) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DPKTLISEPCGIKH, from the internal region of the protein sequence according to NP_005779.1; NP_001138638.1; NP_001138639.1.

Rabbit Polyclonal Anti-PRMT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILS

Anti-PRMT3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 9-23 amino acids of Human protein arginine methyltransferase 3

PRMT3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human PRMT3 (NP_005779.1).
Modifications Unmodified

PRMT3 Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Recombinant Anti-PRMT3 (Clone RAB-C372)

Applications ChIP, ELISA
Reactivities Human
Conjugation His Tag

Recombinant Anti-PRMT3 (Clone RAB-C372)

Applications ChIP, ELISA
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques.