Primary Antibodies

View as table Download

Rabbit polyclonal SCP2 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SCP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-385 amino acids from the Central region of human SCP2.

Rabbit polyclonal Anti-SCP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SCP2 antibody is: synthetic peptide directed towards the N-terminal region of Human SCP2. Synthetic peptide located within the following region: SSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQI

Rabbit polyclonal Anti-SCP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCP2 antibody: synthetic peptide directed towards the middle region of human SCP2. Synthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA

Carrier-free (BSA/glycerol-free) SCP2 mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SCP2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) SCP2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) SCP2 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SCP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SCP2

SCP2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SCP2

SCP2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-322 of human SCP2 (NP_001007099.1).
Modifications Unmodified

SCP2 mouse monoclonal antibody, clone OTI1E4 (formerly 1E4), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

SCP2 mouse monoclonal antibody, clone OTI1E4 (formerly 1E4), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

SCP2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

SCP2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP