Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to Trehalase (trehalase (brush-border membrane glycoprotein))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 7 and 285 of Trehalase (Uniprot ID#O43280)

Rabbit Polyclonal Anti-TREH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TREH antibody is: synthetic peptide directed towards the middle region of Human TREH. Synthetic peptide located within the following region: NYLLNRYYVPYGGPRPESYSKDVELADTLPEGDREALWAELKAGAESGWD

TREH Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TREH