Trehalase (TREH) Rabbit Polyclonal Antibody

CAT#: TA338110

Rabbit Polyclonal Anti-TREH Antibody

Product Images

WB Suggested Anti-TREH Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TREH antibody is: synthetic peptide directed towards the middle region of Human TREH. Synthetic peptide located within the following region: NYLLNRYYVPYGGPRPESYSKDVELADTLPEGDREALWAELKAGAESGWD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: trehalase
• Database Link:
  NP_009111
  Entrez Gene 11181 Human
  UniProt ID O43280
• Background: This gene encodes an enzyme that hydrolyses trehalose, a disaccharide formed from two glucose molecules found mainly in fungi, plants, and insects. A partial duplication of this gene is located adjacent to this locus on chromosome 11.
• Synonyms: TRE; TREA
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%; Mouse: 86%

Reference Data

• Protein Pathways: Starch and sucrose metabolism