Rabbit Polyclonal Anti-Gps2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gps2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gps2. Synthetic peptide located within the following region: LKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLNMQGSPGGHN |
NCR1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 151-303 of human NCR1 (NP_001138929.2). |
| Modifications | Unmodified |
NCR1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 151-303 of human NCR1 (NP_001138929.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
