Primary Antibodies

View as table Download

Rabbit anti-PDGFC polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen peptide coupled to KLH

Rabbit anti-PDGFC polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Partial recombaint protein

Rabbit Polyclonal Anti-PDGFC Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pdgfc antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pdgfc. Synthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV

Rabbit Polyclonal Anti-PDGFC Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS

Rabbit Polyclonal Anti-PDGFC Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PDGFC

PDGFC rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PDGFC

PDGFC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 166-345 of human PDGFC (NP_057289.1).
Modifications Unmodified