PDGFC Rabbit Polyclonal Antibody

CAT#: TA343169

Rabbit Polyclonal Anti-PDGFC Antibody

Product Images

Host: Rabbit; Target Name: PDGFC; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: platelet derived growth factor C
• Database Link:
  NP_057289
  Entrez Gene 54635 MouseEntrez Gene 56034 Human
  UniProt ID Q9NRA1
• Background: The function of this protein remains unknown.
• Synonyms: FALLOTEIN; SCDGF
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells
• Protein Pathways: Cytokine-cytokine receptor interaction, Focal adhesion, Gap junction, Melanoma, Prostate cancer, Regulation of actin cytoskeleton