Primary Antibodies

View as table Download

Rabbit Monoclonal Antibody against DAXX (Clone E94)

Applications FC, IHC, WB
Reactivities Human

DAXX rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Daxx Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Daxx antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human Daxx. The immunogen is located within the last 50 amino acids of Daxx.

Rabbit polyclonal anti-DAXX antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 261-274 of human DAXX protein.

Rabbit Polyclonal Anti-DAXX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAXX antibody is: synthetic peptide directed towards the C-terminal region of Human DAXX. Synthetic peptide located within the following region: VSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHE

DAXX Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human DAXX

DAXX Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse DAXX

Daxx Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 501-740 of human Daxx (NP_001135441.1).
Modifications Unmodified

Daxx Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Daxx