Primary Antibodies

Jump to Filters
View as table Download
Kv1.6 (KCNA6) Rabbit Polyclonal Antibody
AP05127PU-N

USD 360.00

5 Days

Kv1.6 (KCNA6) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide derived from the Rat Kv1.6 potassium channel conjugated to KLH
Kv1.6 (KCNA6) Mouse Monoclonal Antibody [Clone ID: S19-36]
TA326483

USD 410.00

5 Days

Mouse Monoclonal Anti-Kv1.6 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Kcna6 Rabbit Polyclonal Antibody
TA328923

USD 585.00

3 Weeks

Rabbit polyclonal Anti-KV1.6

Applications WB
Reactivities Mouse, Rat
Immunogen GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASGST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEAS RERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat Kv1.6 , (MW: 35 kD