Kv1.6 (KCNA6) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide derived from the Rat Kv1.6 potassium channel conjugated to KLH |
Kv1.6 (KCNA6) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide derived from the Rat Kv1.6 potassium channel conjugated to KLH |
Mouse Monoclonal Anti-Kv1.6 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Anti-KV1.6
Applications | WB |
Reactivities | Mouse, Rat |
Immunogen | GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASGST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEAS RERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat Kv1.6 , (MW: 35 kD |