Primary Antibodies

View as table Download

Goat Anti-LPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RNDSDPTYGQQGHP, from the internal region of the protein sequence according to NP_005569.1.

Rabbit Polyclonal Anti-LPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LPP Antibody: synthetic peptide directed towards the N terminal of human LPP. Synthetic peptide located within the following region: GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST

Rabbit Polyclonal Anti-LPP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LPP

LPP Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse LPP

LPP rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LPP

LPP (6F6) Mouse monoclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Hamster, Human, Monkey, Mouse, Rat
Conjugation Unconjugated