Primary Antibodies

View as table Download

Rabbit polyclonal Anti-Mut Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mut antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mut. Synthetic peptide located within the following region: LAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGP

MMUT rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MMUT