Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-OXA1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OXA1L antibody is: synthetic peptide directed towards the C-terminal region of Human OXA1L. Synthetic peptide located within the following region: NAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS

OXA1L Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 396-495 of human OXA1L (NP_005006.3).
Modifications Unmodified