OXA1L Rabbit Polyclonal Antibody

CAT#: TA339438

Rabbit Polyclonal Anti-OXA1L Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "OXA1L"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-OXA1L antibody is: synthetic peptide directed towards the C-terminal region of Human OXA1L. Synthetic peptide located within the following region: NAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 46 kDa
Gene Name OXA1L, mitochondrial inner membrane protein
Background OXA1L is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. It is essential for the activity and assembly of cytochrome oxidase and is required for the correct biogenesis of ATP synthase and complex I in mitochondria.
Synonyms OXA1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 93%
Reference Data
Protein Families Transmembrane
Protein Pathways Protein export

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.