Primary Antibodies

Jump to Filters
View as table Download
RGS3 Mouse Monoclonal Antibody [Clone ID: 1E8-C7]
AM31041PU-N

USD 480.00

2 Weeks

RGS3 mouse monoclonal antibody, clone 1E8-C7, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
RGS3 Rabbit Polyclonal Antibody
TA318896

USD 380.00

3 Weeks

Rabbit polyclonal anti-RGS3 antibody

Applications WB
Reactivities Human
Immunogen E. coli-expressed human RGS3
RGS3 Rabbit Polyclonal Antibody
TA330393

USD 375.00

5 Days

Rabbit Polyclonal Anti-RGS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RGS3 antibody: synthetic peptide directed towards the C terminal of human RGS3. Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
RGS3 Rabbit Polyclonal Antibody
TA330394

USD 310.00

5 Days

Rabbit Polyclonal Anti-RGS3 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-RGS3 antibody: synthetic peptide directed towards the C terminal of human RGS3. Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL