Primary Antibodies

View as table Download

BACH2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BACH2

Rabbit Polyclonal Anti-BACH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BACH2 antibody: synthetic peptide directed towards the middle region of human BACH2. Synthetic peptide located within the following region: SGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDYT

Rabbit polyclonal anti-Bach2 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Anti-Bach2 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the n-terminus region of the Bach2 protein.

Rabbit Polyclonal Anti-BACH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BACH2 Antibody: synthetic peptide directed towards the middle region of human BACH2. Synthetic peptide located within the following region: TSGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDY

BACH2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 282-312 amino acids from the Central region of human BACH2

BACH2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BACH2