BACH2 Rabbit Polyclonal Antibody

CAT#: TA345341

Rabbit Polyclonal Anti-BACH2 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human BTB and CNC homology 1, basic leucine zipper transcription factor 2 (BACH2)
    • 20 ug

USD 867.00


Transient overexpression lysate of BTB and CNC homology 1, basic leucine zipper transcription factor 2 (BACH2), transcript variant 1
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "BACH2"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-BACH2 antibody: synthetic peptide directed towards the middle region of human BACH2. Synthetic peptide located within the following region: SGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDYT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 93 kDa
Gene Name BTB domain and CNC homolog 2
Background BACH2 belongs to the bZIP family. It is a transcriptional regulator that acts as repressor or activator. The protein binds to Maf recognition elements (MARE) and play important roles in coordinating transcription activation and repression by MAFK.
Synonyms BTBD25
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.