BACH2 Rabbit Polyclonal Antibody

CAT#: TA345341

Rabbit Polyclonal Anti-BACH2 Antibody

Product Images

WB Suggested Anti-BACH2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate; BACH2 is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Human Tonsil

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BACH2 antibody: synthetic peptide directed towards the middle region of human BACH2. Synthetic peptide located within the following region: SGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDYT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 93 kDa
• Gene Name: BTB domain and CNC homolog 2
• Database Link:
  NP_068585
  Entrez Gene 60468 Human
  UniProt ID Q9BYV9
• Background: BACH2 belongs to the bZIP family. It is a transcriptional regulator that acts as repressor or activator. The protein binds to Maf recognition elements (MARE) and play important roles in coordinating transcription activation and repression by MAFK.
• Synonyms: BTBD25
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors