Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to CaMK1D (calcium/calmodulin-dependent protein kinase ID)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 385 of CaMK1D (Uniprot ID#Q8IU85)

Rabbit Polyclonal Anti-CAMK1D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAMK1D antibody: synthetic peptide directed towards the middle region of human CAMK1D. Synthetic peptide located within the following region: KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS

Rabbit Polyclonal Anti-CAMK1D Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Camk1d antibody is: synthetic peptide directed towards the N-terminal region of Mouse Camk1d. Synthetic peptide located within the following region: LAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIY

CAMK1D (1-96) mouse monoclonal antibody, clone 3H8, Purified

Applications ELISA, IHC, WB
Reactivities Human

Goat Anti-CAMK1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ASQKDCAYVAKPES, from the C Terminus of the protein sequence according to NP_065130.1.

Rabbit polyclonal antibody to CAMK1D (calcium/calmodulin-dependent protein kinase ID)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 205 of CaMK1D (Uniprot ID#Q8IU85)

Rabbit polyclonal antibody to CAMK1D (calcium/calmodulin-dependent protein kinase ID)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 81 and 385 of CAMK1D (Uniprot ID#Q8IU85)

CAMK1D (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CAMK1D

Carrier-free (BSA/glycerol-free) CAMK1D mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CAMK1D Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CAMK1D

CAMK1D Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human CAMK1D

CAMK1D rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CAMK1D

Anti-CAMK1D mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-CAMK1D mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-CAMK1D mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated