Primary Antibodies

Jump to Filters
View as table Download
DECTIN 2 (CLEC6A) Mouse Monoclonal Antibody [Clone ID: 3D1]
TA337142

USD 424.00

5 Days

Mouse Monoclonal Dectin-2/CLEC6A Antibody (3D1)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
DECTIN 2 (CLEC6A) Rabbit Polyclonal Antibody
TA315998

USD 345.00

4 Weeks

Rabbit polyclonal anti-CLEC6A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CLEC6A.
DECTIN 2 (CLEC6A) Rabbit Polyclonal Antibody
TA336156

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLEC6A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLEC6A Antibody: synthetic peptide directed towards the N terminal of human CLEC6A. Synthetic peptide located within the following region: FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK
DECTIN 2 (CLEC6A) Rabbit Polyclonal Antibody
TA351130

USD 345.00

In Stock

Rabbit Polyclonal Anti-CLEC6A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLEC6A
CLEC6A Rabbit Polyclonal Antibody
TA384016

USD 380.00

4 Weeks

Dectin-2 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthesized peptide derived from the Internal region of human Dectin-2.