DECTIN 2 (CLEC6A) Rabbit Polyclonal Antibody

CAT#: TA336156

Rabbit Polyclonal Anti-CLEC6A Antibody

Product Images

WB Suggested Anti-CLEC6A Antibody Titration: 0.2-1 ug/ml; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CLEC6A Antibody: synthetic peptide directed towards the N terminal of human CLEC6A. Synthetic peptide located within the following region: FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: C-type lectin domain family 6 member A
• Database Link:
  NP_001007034
  Entrez Gene 93978 Human
  UniProt ID Q6EIG7
• Background: CLEC6A may be involved in regulating immune reactivity.
• Synonyms: CLEC4N; CLECSF10
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 90%; Mouse: 90%; Bovine: 85%

Reference Data

• Protein Families: Transmembrane