Antibodies

View as table Download

Mouse Monoclonal Dectin-2/CLEC6A Antibody (3D1)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti-CLEC6A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CLEC6A.

Rabbit Polyclonal Anti-CLEC6A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLEC6A Antibody: synthetic peptide directed towards the N terminal of human CLEC6A. Synthetic peptide located within the following region: FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK

Rabbit Polyclonal Anti-CLEC6A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLEC6A

Dectin-2 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthesized peptide derived from the Internal region of human Dectin-2.