Mouse Monoclonal Dectin-2/CLEC6A Antibody (3D1)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Dectin-2/CLEC6A Antibody (3D1)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-CLEC6A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CLEC6A. |
Rabbit Polyclonal Anti-CLEC6A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CLEC6A Antibody: synthetic peptide directed towards the N terminal of human CLEC6A. Synthetic peptide located within the following region: FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK |
Rabbit Polyclonal Anti-CLEC6A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CLEC6A |
Dectin-2 Rabbit polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthesized peptide derived from the Internal region of human Dectin-2. |