Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to CSE1L (CSE1 chromosome segregation 1-like (yeast))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 222 and 469 of CSE1L (Uniprot ID#P55060)

Rabbit polyclonal anti-CSE1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CSE1.

Rabbit Polyclonal Anti-CSE1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSE1L antibody: synthetic peptide directed towards the N terminal of human CSE1L. Synthetic peptide located within the following region: ELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLE

Carrier-free (BSA/glycerol-free) CSE1L mouse monoclonal antibody,clone OTI4G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Exportin 2 (XPO2) Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Exportin 2 (XPO2) (NP_001243064.1).
Modifications Unmodified

CSE1L mouse monoclonal antibody,clone OTI4G1, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

CSE1L mouse monoclonal antibody,clone OTI4G1, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP