Goat polyclonal anti-Artemis antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 482-495 of Human ARTEMIS (DCLRE1C DNA cross-link repair 1C). |
Rabbit Polyclonal Anti-DCLRE1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the N terminal of human DCLRE1C. Synthetic peptide located within the following region: SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL |
Rabbit Polyclonal Artemis Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to residues 677-692 [GESIAVKKRKCSLLDT] of the human Artemis protein. |
Rabbit Polyclonal Anti-DCLRE1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the C terminal of human DCLRE1C. Synthetic peptide located within the following region: SQSPKLFSDSDGESTHISSQNSSQSTHITEQGSQGWDSQSDTVLLSSQER |
Phospho-Artemis (Ser516) Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Artemis around the phosphorylation site of Ser516. AA range:482-531 (Phosphorylated) |
Germany
Japan
United Kingdom
China
