Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GABPA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABPA antibody: synthetic peptide directed towards the C terminal of human GABPA. Synthetic peptide located within the following region: KWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIG

Rabbit Polyclonal anti-Gabpa Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gabpa antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gabpa. Synthetic peptide located within the following region: MTKREAEELIEIEIDGTEKAECTEESIVEQTYTPAECVSQAIDINEPIGN

GABPA Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABPA (NP_002031.2).
Modifications Unmodified

GABPA Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABPA (NP_002031.2).
Modifications Unmodified

GABPA Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human GABPA (NP_002031.2).
Modifications Unmodified