GABPA Rabbit Polyclonal Antibody

CAT#: TA330090

Rabbit Polyclonal Anti-GABPA Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "GABPA"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GABPA antibody: synthetic peptide directed towards the C terminal of human GABPA. Synthetic peptide located within the following region: KWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 51 kDa
Gene Name GA binding protein transcription factor alpha subunit
Background GA Binding Protein . chain (GABP-. subunit, GABPA, nuclear respiratory factor-2 subunit . transcription factor E4TF1-60) is one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is likely involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. This subunit also shares identity with a subunit constituting the transcription factor E4TF1, responsible for expression of the adenovirus E4 gene. Because of its chromosomal localization and ability to form heterodimers with other polypeptides, this gene may play a role in the Down Syndrome phenotype.
Synonyms E4TF1-60; E4TF1A; NFT2; NRF2; NRF2A; RCH04A07
Note Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.