Primary Antibodies

View as table Download

HSD17B1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HSD17B1

Rabbit Polyclonal Anti-HSD17B1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD17B1 antibody: synthetic peptide directed towards the N terminal of human HSD17B1. Synthetic peptide located within the following region: MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA

HSD17B1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 226-256 amino acids from the C-terminal region of human 17-beta-HSD1 / HSD17B1

Rabbit Polyclonal Anti-HSD17B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HSD17B1

HSD17B1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-328 of human HSD17B1 (NP_000404.2).
Modifications Unmodified