Primary Antibodies

View as table Download

Rabbit polyclonal Kir5.1 (Ab-416) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Kir5.1 around the phosphorylation site of serine 416 (M-E-SP-Q-M).

Rabbit polyclonal Anti-Kir5.1

Applications IHC, WB
Reactivities Mouse, Rat
Immunogen Peptide HDVLEVKRKYYKVNC, corresponding to amino acid residues 311-325 of rat Kir5.1 . Intracellular, C-terminal.

Rabbit Polyclonal Anti-KCNJ16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ16 antibody: synthetic peptide directed towards the middle region of human KCNJ16. Synthetic peptide located within the following region: RESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTL

Rabbit Polyclonal Anti-Kcnj16 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Kcnj16 antibody is: synthetic peptide directed towards the C-terminal region of Rat Kcnj16. Synthetic peptide located within the following region: VTFIYTGDSTGTSHQSRSSYVPREILWGHRFHDVLEVKRKYYKVNCLQFE

KCNJ16 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human KCNJ16.