KIR5.1 (KCNJ16) Rabbit Polyclonal Antibody

CAT#: TA338587

Rabbit Polyclonal Anti-Kcnj16 Antibody

Product Images

Host: Rabbit; Target Name: Kcnj16; Sample Tissue: Rat Thymus lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Kcnj16 antibody is: synthetic peptide directed towards the C-terminal region of Rat Kcnj16. Synthetic peptide located within the following region: VTFIYTGDSTGTSHQSRSSYVPREILWGHRFHDVLEVKRKYYKVNCLQFE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: potassium voltage-gated channel subfamily J member 16
• Database Link:
  NP_061128
  Entrez Gene 29719 Rat
  UniProt ID Q9NPI9
• Background: inward rectifying potassium channel; may be involved in renal pH regulation [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: BC078776.1 [ECO:0000332] ##Evidence-Data-END##
• Synonyms: BIR9; KIR5.1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane