Primary Antibodies

View as table Download

MAN2A2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 766-796 amino acids from the Central region of human MAN2A2

Rabbit Polyclonal Anti-Man2a2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Man2a2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PQDCQFALGGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWD

MAN2A2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MAN2A2

MAN2A2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human MAN2A2.
Modifications Unmodified