Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MAP3K14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K14 antibody: synthetic peptide directed towards the N terminal of human MAP3K14. Synthetic peptide located within the following region: SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN

Rabbit Polyclonal NIK/MAP3K14 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human MAP3K14 protein (between residues 800-900) [UniProt Q99558]

NFkB Inducing Kinase NIK (MAP3K14) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Rat
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the center region of human NIK.

Rabbit Polyclonal NIK Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen NIK antibody was raised against a 17 amino acid peptide near the carboxy terminus of human NIK. The immunogen is located within the last 50 amino acids of NIK.

Anti-MAP3K14 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human mitogen-activated protein kinase kinase kinase 14

Anti-MAP3K14 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human mitogen-activated protein kinase kinase kinase 14

MAP3K14 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 648-947 of human MAP3K14 (NP_003945.2).
Modifications Unmodified