Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MCM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the middle region of human MCM4. Synthetic peptide located within the following region: VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE

Rabbit Polyclonal Anti-MCM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the N terminal of human MCM4. Synthetic peptide located within the following region: SRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSL

Rabbit Polyclonal Anti-MCM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the C terminal of human MCM4. Synthetic peptide located within the following region: KEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRAL

Anti-MCM4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 837-850 amino acids of Human minichromosome maintenance complex component 4

Mcm4 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated

MCM4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human MCM4 (NP_877423.1).
Modifications Unmodified