Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NAGA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAGA antibody is: synthetic peptide directed towards the N-terminal region of NAGA. Synthetic peptide located within the following region: GYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYA

Rabbit Polyclonal Anti-NAGA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAGA antibody is: synthetic peptide directed towards the middle region of Human NAGA. Synthetic peptide located within the following region: CFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLAD

Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI6F3

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI7F1

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI8H7

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI3A4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NAGA Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse NAGA

NAGA Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 312-411 of human NAGA (NP_000253.1).
Modifications Unmodified

NAGA mouse monoclonal antibody,clone OTI6F3

Applications WB
Reactivities Human
Conjugation Unconjugated

NAGA mouse monoclonal antibody,clone OTI6F3, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

NAGA mouse monoclonal antibody,clone OTI6F3

Applications WB
Reactivities Human
Conjugation Unconjugated

NAGA mouse monoclonal antibody,clone OTI7F1

Applications WB
Reactivities Human
Conjugation Unconjugated

NAGA mouse monoclonal antibody,clone OTI7F1, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

NAGA mouse monoclonal antibody,clone OTI7F1

Applications WB
Reactivities Human
Conjugation Unconjugated

NAGA mouse monoclonal antibody,clone OTI8H7

Applications WB
Reactivities Human
Conjugation Unconjugated

NAGA mouse monoclonal antibody,clone OTI8H7, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

NAGA mouse monoclonal antibody,clone OTI8H7

Applications WB
Reactivities Human
Conjugation Unconjugated

NAGA mouse monoclonal antibody,clone OTI3A4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NAGA mouse monoclonal antibody,clone OTI3A4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated