NAGA Rabbit Polyclonal Antibody

CAT#: TA343290

Rabbit Polyclonal Anti-NAGA Antibody

Product Images

Host: Rabbit; Target Name: NAGA; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NAGA antibody is: synthetic peptide directed towards the middle region of Human NAGA. Synthetic peptide located within the following region: CFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLAD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: alpha-N-acetylgalactosaminidase
• Database Link:
  NP_000253
  Entrez Gene 4668 Human
  UniProt ID P17050
• Background: NAGA encodes the lysosomal enzyme alpha-N-acetylgalactosaminidase, which cleaves alpha-N-acetylgalactosaminyl moieties from glycoconjugates. Mutations in NAGA have been identified as the cause of Schindler disease types I and II (type II also known as Kanzaki disease).
• Synonyms: D22S674; GALB
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Rabbit: 86%; Pig: 79%; Rat: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glycosphingolipid biosynthesis - globo series, Lysosome