Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NUP50 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUP50 antibody: synthetic peptide directed towards the C terminal of human NUP50. Synthetic peptide located within the following region: TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED

NUP50 (C-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human NUP50.

NUP50 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 223-252 amino acids from the Central region of human NUP50.

Goat Polyclonal Antibody against NUP50

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ELHKILLEKKDA, from the C Terminus of the protein sequence according to NP_009103; NP_705931; NP_710151.

Rabbit Polyclonal Anti-Npap60 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Npap60 antibody is: synthetic peptide directed towards the N-terminal region of Rat Npap60. Synthetic peptide located within the following region: VEEMGTFSVASEEVMKNRAVKKAKRRNIGFESDSGGAFKGFKGLVVPSGG

Rabbit Polyclonal Anti-NUP50 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NUP50

NUP50 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NUP50

NUP50 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 299-468 of human NUP50 (NP_009103.2).
Modifications Unmodified